PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016490759.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 837aa    MW: 94450.6 Da    PI: 9.9127
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016490759.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.12.7e-1223110398
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     k+    + ++ +rl++pk+fa+++ ++  ++  + le +sg++Wev++    ++g++ l+ GW++F +   +  g f++F ++ rs f  +v++f
  XP_016490759.1  23 KII--FSQHECSRLRIPKDFASRYCKNMLNP--VYLEVPSGEVWEVEV--VHSQGQICLGIGWQDFSDFYSISCGHFLIFGYNARSHF--NVTIF 109
                     555..23444568***********5454444..***************..999999**************************999999..99998 PP

                     - CS
              B3  98 r 98 
                     +
  XP_016490759.1 110 D 110
                     7 PP

2B346.47.3e-15276368498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      + ps+v++   l++  +fa ++ +++ ++  l++  +   sW+vk+  + ++      +GWk Fv +n+Lk gD++vF++++ ++    v++fr
  XP_016490759.1 276 FMQPSYVFSPFHLSIALNFAGKYFLENYGNLVLRVPGRGRGSWSVKC--TTGGTNAKVHSGWKAFVLDNKLKCGDVCVFEVIKGTRLFIDVTIFR 368
                     6789*******************88888887888888888*******..8888888899*********************987655556677766 PP

3B342.61.1e-13541631599
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     + ps+v++  rl ++  fa+++ +++ ++  l+l+ +   sW vk+    ++ ++ ++  Wk Fv +n+Lk gD++vF+l++ ++  l v++fr+
  XP_016490759.1 541 MQPSYVSTPYRLHISFLFARKYFLEE-CG-NLVLRVPGRGSWPVKYALGISKTQICFS--WKAFVLDNKLKFGDVCVFELIKGTKPILDVTIFRA 631
                     6799******************9884.44.8***************999999999998..*********************88777788888885 PP

4B351.12.4e-16742828794
                     .-HHHHT...T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   7 psdvlks...grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     ps+v++     +l++  + a+++     ++ +++l+ +s +sW vk+i   +     lt+GWkeFv +n+Lk+gD++vF++++rs+  ++v
  XP_016490759.1 742 PSYVSSAsgpMQLSITLSRARKFFAT--RHSDVVLKVSSKKSWAVKCIL--GTANAKLTSGWKEFVLDNNLKVGDVCVFERVSRSKLLFNV 828
                     44444445567899999999999755..4558***************65..333346***********************88776664444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.5E-1815112IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-1815112IPR015300DNA-binding pseudobarrel domain
CDDcd100171.47E-1119110No hitNo description
PROSITE profilePS5086311.06819112IPR003340B3 DNA binding domain
SMARTSM010192.1E-922112IPR003340B3 DNA binding domain
PfamPF023626.9E-922110IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.2E-19265370IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.68E-18266369IPR015300DNA-binding pseudobarrel domain
CDDcd100176.58E-15271368No hitNo description
SMARTSM010193.3E-9273370IPR003340B3 DNA binding domain
PROSITE profilePS5086311.265273370IPR003340B3 DNA binding domain
PfamPF023625.9E-12275368IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-18530631IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.49E-18531631IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.265537632IPR003340B3 DNA binding domain
SMARTSM010192.6E-12540632IPR003340B3 DNA binding domain
CDDcd100174.73E-17541630No hitNo description
PfamPF023621.1E-10541631IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-22728832IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.89E-20729832IPR015300DNA-binding pseudobarrel domain
CDDcd100174.04E-15734831No hitNo description
SMARTSM010192.7E-9739834IPR003340B3 DNA binding domain
PROSITE profilePS5086312.774739834IPR003340B3 DNA binding domain
PfamPF023622.0E-14747830IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 837 aa     Download sequence    Send to blast
MNCQRLAMAA KPQLQIPQPK FFKIIFSQHE CSRLRIPKDF ASRYCKNMLN PVYLEVPSGE  60
VWEVEVVHSQ GQICLGIGWQ DFSDFYSISC GHFLIFGYNA RSHFNVTIFD LSASEIEYPY  120
SSAHNIHTPI SHCHETRCAP KRDQSESDDT VEILEDIPRS QKAKAIIPDT VEHSVENLRH  180
CPLEQSSKRK RQERNAEDVV SVDMHVKRMK VEKLQEDVAS PSFIREGQKS NKGCRMHKQQ  240
SDSVYGQNKT VMDKERAVAY QRAKAFKSKN PFIISFMQPS YVFSPFHLSI ALNFAGKYFL  300
ENYGNLVLRV PGRGRGSWSV KCTTGGTNAK VHSGWKAFVL DNKLKCGDVC VFEVIKGTRL  360
FIDVTIFRAA GSTLMHKIVG EVPGGSDSKS KVIKTDSSVP CSQRKVVHTK KLKQRTGGSN  420
GFYSKIKEHG EGTEIEHSVE ICGHCPLGQG SKRKRSEGET KDDVSIDIHT KSIKVENTQE  480
DVASPSFTRK TKKSGESCRM DKQQSKMVYD KNKTVLDKER TVPYQRAKTF KCENPYVMYF  540
MQPSYVSTPY RLHISFLFAR KYFLEECGNL VLRVPGRGSW PVKYALGISK TQICFSWKAF  600
VLDNKLKFGD VCVFELIKGT KPILDVTIFR AAESKAMHKI DGKLAGVSDS KNKTIKTEKS  660
IPCSQPKIVH SRKLNLEKKQ KGDSDGFTSK IKEEFSEDTG KHVQQSKSSC KGSEVAKEMV  720
LAYQRAKAFT SENPFFICFM QPSYVSSASG PMQLSITLSR ARKFFATRHS DVVLKVSSKK  780
SWAVKCILGT ANAKLTSGWK EFVLDNNLKV GDVCVFERVS RSKLLFNVII FTSAEGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A3e-1524283518144B3 domain-containing transcription factor VRN
4i1k_B3e-1524283518144B3 domain-containing transcription factor VRN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188209RKRQERNAEDVVSVDMHVKRMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016490759.10.0PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform X1
TrEMBLK4B4X60.0K4B4X6_SOLLC; Uncharacterized protein
STRINGSolyc02g021260.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-39B3 family protein